Lineage for d3m4ua_ (3m4u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116819Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255955] (1 PDB entry)
  8. 2116820Domain d3m4ua_: 3m4u A: [247608]
    automated match to d2h4vb_
    complexed with po4

Details for d3m4ua_

PDB Entry: 3m4u (more details), 2.39 Å

PDB Description: crystal structure of trypanosoma brucei protein tyrosine phosphatase tbptp1
PDB Compounds: (A:) Tyrosine specific protein phosphatase, putative

SCOPe Domain Sequences for d3m4ua_:

Sequence, based on SEQRES records: (download)

>d3m4ua_ c.45.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
sfpmaqlstraqysrmqrefvqlqrqenprninfttslknrhknryldilaneetiyppv
lkavgaqpgrypyingnlidldlphtfvacqapvpqgvpdfletlsekkvdlvvmltklr
eggvlkaerywpeeeedslsfpesghdaikvtrdaeasyevdaeldivrrplvihvpgkp
mhrvlqvqyvgwpdhgvpesaasfdellsvikncvttspilvhcsagigrtgtligayaa
llhiergiltdstvysivaamkqkrfgmvqrleqyaviymtvlgrlgvdisglvst

Sequence, based on observed residues (ATOM records): (download)

>d3m4ua_ c.45.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
sfpmaqlstraqysrmqrefvqlqrqenprninfttslknrhknryldilaneetiyppv
grypyingnlidldlphtfvacqapvpqgvpdfletlsekkvdlvvmltklreggvlkae
rywpeeeedslsfpesghdaikvtrdsyevdaeldivrrplvihvpgkpmhrvlqvqyvg
wpdhgvpesaasfdellsvikncvttspilvhcsagigrtgtligayaallhiergiltd
stvysivaamkqkrfgmvqrleqyaviymtvlgrlgvdisglvst

SCOPe Domain Coordinates for d3m4ua_:

Click to download the PDB-style file with coordinates for d3m4ua_.
(The format of our PDB-style files is described here.)

Timeline for d3m4ua_: