Lineage for d1ykfd1 (1ykf D:1-150,D:315-352)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies) Superfamily b.35.1: GroES-like [50129] (2 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins) 
Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) 
Species Thermoanaerobacter brockii [TaxId:29323] [50144] (2 PDB entries) 
Domain d1ykfd1: 1ykf D:1-150,D:315-352 [24760]
Other proteins in same PDB: d1ykfa2, d1ykfb2, d1ykfc2, d1ykfd2
Details for d1ykfd1
PDB Entry: 1ykf (more details), 2.5 Å
PDB Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
SCOP Domain Sequences for d1ykfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykfd1 b.35.1.2 (D:1-150,D:315-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeipleaavmipdXdpsklvthvfrgfdniekafmlmkdkpkd
likpvvila
SCOP Domain Coordinates for d1ykfd1:
Click to download the PDB-style file with coordinates for d1ykfd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ykfd1:
View in 3D
