SCOPe 2.08: Domain d1ykfd1: 1ykf D:1-139,D:314-352

Lineage for d1ykfd1 (1ykf D:1-139,D:314-352)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)

7. Species Thermoanaerobacter brockii [TaxId:29323] [50144] (3 PDB entries)

8. Domain d1ykfd1: 1ykf D:1-139,D:314-352 [24760]
   Other proteins in same PDB: d1ykfa2, d1ykfb2, d1ykfc2, d1ykfd2
   complexed with nap, zn

Details for d1ykfd1

PDB Entry: 1ykf, 2.5 Å

PDB Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii

PDB Compounds: (D:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1ykfd1:

Sequence; same for both SEQRES and ATOM records:

>d1ykfd1 b.35.1.2 (D:1-139,D:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila

Timeline for d1ykfd1:

• d1ykfd1 first appeared (with stable ids) in SCOP 1.55
  
• d1ykfd1 appears in SCOPe 2.07