Lineage for d3m3yk_ (3m3y K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564986Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2565024Protein automated matches [190337] (2 species)
    not a true protein
  7. 2565025Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (5 PDB entries)
  8. 2565027Domain d3m3yk_: 3m3y K: [247597]
    Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yl_
    automated match to d1twfk_
    protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3yk_

PDB Entry: 3m3y (more details), 3.18 Å

PDB Description: RNA polymerase II elongation complex C
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d3m3yk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3yk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d3m3yk_:

Click to download the PDB-style file with coordinates for d3m3yk_.
(The format of our PDB-style files is described here.)

Timeline for d3m3yk_: