| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) ![]() automatically mapped to Pfam PF01194 |
| Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
| Protein automated matches [190336] (5 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187159] (5 PDB entries) |
| Domain d3m3yj_: 3m3y J: [247596] Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yk_, d3m3yl_ automated match to d1twfj_ protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn |
PDB Entry: 3m3y (more details), 3.18 Å
SCOPe Domain Sequences for d3m3yj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3yj_ a.4.11.1 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp
Timeline for d3m3yj_: