Lineage for d3m3yj_ (3m3y J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309044Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2309045Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2309083Protein automated matches [190336] (5 species)
    not a true protein
  7. 2309084Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187159] (5 PDB entries)
  8. 2309086Domain d3m3yj_: 3m3y J: [247596]
    Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yk_, d3m3yl_
    automated match to d1twfj_
    protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3yj_

PDB Entry: 3m3y (more details), 3.18 Å

PDB Description: RNA polymerase II elongation complex C
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit RPABC5

SCOPe Domain Sequences for d3m3yj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3yj_ a.4.11.1 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d3m3yj_:

Click to download the PDB-style file with coordinates for d3m3yj_.
(The format of our PDB-style files is described here.)

Timeline for d3m3yj_: