SCOPe 2.07: Domain d3m3yf_: 3m3y F:

Lineage for d3m3yf_ (3m3y F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (2 proteins)

6. Protein automated matches [254699] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255949] (3 PDB entries)

8. Domain d3m3yf_: 3m3y F: [247592]
   Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_
   automated match to d1twff_
   protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3yf_

PDB Entry: 3m3y, 3.18 Å

PDB Description: RNA polymerase II elongation complex C

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOPe Domain Sequences for d3m3yf_:

Sequence; same for both SEQRES and ATOM records:

>d3m3yf_ a.143.1.2 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d3m3yf_:

• d3m3yf_ first appeared in SCOPe 2.04
  
• d3m3yf_ appears in SCOPe 2.06
  
• d3m3yf_ appears in the current release, SCOPe 2.08