| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
| Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
| Protein automated matches [254701] (3 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255951] (3 PDB entries) |
| Domain d3m3ye1: 3m3y E:2-143 [247590] Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_ automated match to d1dzfa1 protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn |
PDB Entry: 3m3y (more details), 3.18 Å
SCOPe Domain Sequences for d3m3ye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3ye1 c.52.3.1 (E:2-143) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn
Timeline for d3m3ye1: