Lineage for d3m3ye1 (3m3y E:2-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490853Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2490854Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2490888Protein automated matches [254701] (3 species)
    not a true protein
  7. 2490889Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255951] (3 PDB entries)
  8. 2490890Domain d3m3ye1: 3m3y E:2-143 [247590]
    Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_
    automated match to d1dzfa1
    protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3ye1

PDB Entry: 3m3y (more details), 3.18 Å

PDB Description: RNA polymerase II elongation complex C
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3m3ye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3ye1 c.52.3.1 (E:2-143) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

SCOPe Domain Coordinates for d3m3ye1:

Click to download the PDB-style file with coordinates for d3m3ye1.
(The format of our PDB-style files is described here.)

Timeline for d3m3ye1: