Lineage for d3m3ma2 (3m3m A:81-200)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2323102Species Pseudomonas fluorescens [TaxId:220664] [255948] (2 PDB entries)
  8. 2323103Domain d3m3ma2: 3m3m A:81-200 [247587]
    Other proteins in same PDB: d3m3ma1, d3m3ma3
    automated match to d4l8ea2
    complexed with edo, gsh, na

Details for d3m3ma2

PDB Entry: 3m3m (more details), 1.75 Å

PDB Description: Crystal structure of glutathione S-transferase from Pseudomonas fluorescens [Pf-5]
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3m3ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3ma2 a.45.1.0 (A:81-200) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
lpseprlrtqvlqwqffeqyshepyiavarfiqlyeglpeerreeylklhkrgykaldvm
ekqlsrtpylvgehysiadialyaythvadeggfdlsrypgiqawmqrvqshprhvpmld

SCOPe Domain Coordinates for d3m3ma2:

Click to download the PDB-style file with coordinates for d3m3ma2.
(The format of our PDB-style files is described here.)

Timeline for d3m3ma2: