| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Pseudomonas fluorescens [TaxId:220664] [255948] (2 PDB entries) |
| Domain d3m3ma2: 3m3m A:81-200 [247587] Other proteins in same PDB: d3m3ma1, d3m3ma3 automated match to d4l8ea2 complexed with edo, gsh, na |
PDB Entry: 3m3m (more details), 1.75 Å
SCOPe Domain Sequences for d3m3ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3ma2 a.45.1.0 (A:81-200) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
lpseprlrtqvlqwqffeqyshepyiavarfiqlyeglpeerreeylklhkrgykaldvm
ekqlsrtpylvgehysiadialyaythvadeggfdlsrypgiqawmqrvqshprhvpmld
Timeline for d3m3ma2: