SCOPe 2.06: Domain d3m3ha1: 3m3h A:1-210

Lineage for d3m3ha1 (3m3h A:1-210)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)

8. Domain d3m3ha1: 3m3h A:1-210 [247585]
   Other proteins in same PDB: d3m3ha2
   automated match to d2aeeb_
   complexed with cl

Details for d3m3ha1

PDB Entry: 3m3h, 1.75 Å

PDB Description: 1.75 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor'

PDB Compounds: (A:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3m3ha1:

Sequence, based on SEQRES records:

>d3m3ha1 c.61.1.0 (A:1-210) automated matches {Bacillus anthracis [TaxId: 261594]}
mkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleelike
hfptveviagtatagiahaawvsdrmdlpmcyvrskakghgkgnqiegkaekgqkvvvve
dlistggsaitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysaltev
aaekgiigqaetkklqewrknpadeawita

Sequence, based on observed residues (ATOM records):

>d3m3ha1 c.61.1.0 (A:1-210) automated matches {Bacillus anthracis [TaxId: 261594]}
mkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleelike
hfptveviagtgiahaawvsdrmdlpmcyvrnqiegkaekgqkvvvvedlistggsaitc
vealreagcevlgivsiftyeleagkekleaanvasyslsdysaltevaaekgiigqaet
kklqewrknpadeawita

Timeline for d3m3ha1:

• d3m3ha1 first appeared in SCOPe 2.04, called d3m3ha_
  
• d3m3ha1 was called d3m3ha_ in SCOPe 2.05
  
• d3m3ha1 appears in SCOPe 2.07
  
• d3m3ha1 appears in the current release, SCOPe 2.08