![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d3m1bf_: 3m1b F: [247572] Other proteins in same PDB: d3m1ba1, d3m1ba2, d3m1bc1, d3m1bc2, d3m1be1, d3m1be2, d3m1bg1, d3m1bg2 automated match to d1k5nb_ |
PDB Entry: 3m1b (more details), 3.1 Å
SCOPe Domain Sequences for d3m1bf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m1bf_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d3m1bf_: