Lineage for d3m1be2 (3m1b E:177-267)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752303Domain d3m1be2: 3m1b E:177-267 [247571]
    Other proteins in same PDB: d3m1ba1, d3m1bb_, d3m1bc1, d3m1bd_, d3m1be1, d3m1bf_, d3m1bg1, d3m1bh_
    automated match to d3frua1

Details for d3m1be2

PDB Entry: 3m1b (more details), 3.1 Å

PDB Description: crystal structure of human fcrn with a dimeric peptide inhibitor
PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d3m1be2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m1be2 b.1.1.2 (E:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

SCOPe Domain Coordinates for d3m1be2:

Click to download the PDB-style file with coordinates for d3m1be2.
(The format of our PDB-style files is described here.)

Timeline for d3m1be2: