SCOPe 2.08: Domain d3m1be1: 3m1b E:5-176

Lineage for d3m1be1 (3m1b E:5-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d3m1be1: 3m1b E:5-176 [247570]
   Other proteins in same PDB: d3m1ba2, d3m1bb_, d3m1bc2, d3m1bd_, d3m1be2, d3m1bf_, d3m1bg2, d3m1bh_
   automated match to d3frua2

Details for d3m1be1

PDB Entry: 3m1b, 3.1 Å

PDB Description: crystal structure of human fcrn with a dimeric peptide inhibitor

PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d3m1be1:

Sequence; same for both SEQRES and ATOM records:

>d3m1be1 d.19.1.0 (E:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke
ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq
gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

Timeline for d3m1be1:

• d3m1be1 first appeared in SCOPe 2.04
  
• d3m1be1 appears in SCOPe 2.07