Lineage for d1pedd1 (1ped D:1-150,D:315-351)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165795Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 165796Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 165846Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 165952Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 165953Species Clostridium beijerinckii [50143] (2 PDB entries)
  8. 165961Domain d1pedd1: 1ped D:1-150,D:315-351 [24756]
    Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2

Details for d1pedd1

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

SCOP Domain Sequences for d1pedd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedd1 b.35.1.2 (D:1-150,D:315-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdmplenavmitdXdlsklvthvyhgfdhieealllmkdkpkd
likavvil

SCOP Domain Coordinates for d1pedd1:

Click to download the PDB-style file with coordinates for d1pedd1.
(The format of our PDB-style files is described here.)

Timeline for d1pedd1: