Lineage for d1pedd1 (1ped D:1-150,D:315-351)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies) Superfamily b.35.1: GroES-like [50129] (2 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins) 
Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) Species Clostridium beijerinckii [50143] (2 PDB entries) 
Domain d1pedd1: 1ped D:1-150,D:315-351 [24756]
Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2
Details for d1pedd1
PDB Entry: 1ped (more details), 2.15 Å
PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)
SCOP Domain Sequences for d1pedd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pedd1 b.35.1.2 (D:1-150,D:315-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdmplenavmitdXdlsklvthvyhgfdhieealllmkdkpkd
likavvil
SCOP Domain Coordinates for d1pedd1:
Click to download the PDB-style file with coordinates for d1pedd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pedd1:
View in 3D
