SCOPe 2.08: Domain d3lykb2: 3lyk B:88-201

Lineage for d3lykb2 (3lyk B:88-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [255944] (1 PDB entry)

8. Domain d3lykb2: 3lyk B:88-201 [247559]
   Other proteins in same PDB: d3lyka1, d3lyka3, d3lykb1, d3lykb3
   automated match to d4hoja2

Details for d3lykb2

PDB Entry: 3lyk, 2.1 Å

PDB Description: structure of stringent starvation protein a homolog from haemophilus influenzae

PDB Compounds: (B:) Stringent starvation protein A homolog

SCOPe Domain Sequences for d3lykb2:

Sequence; same for both SEQRES and ATOM records:

>d3lykb2 a.45.1.0 (B:88-201) automated matches {Haemophilus influenzae [TaxId: 727]}
lmqvypvsrakdrllmlrieqdwyptlakaengtekektsalkqlkeellgiapifqqmp
yfmneefglvdcyvapllwklkhlgveftgtgskaikaymervftrdsflqsvg

Timeline for d3lykb2:

• d3lykb2 first appeared in SCOPe 2.04
  
• d3lykb2 appears in SCOPe 2.07