Lineage for d3lykb2 (3lyk B:88-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714000Species Haemophilus influenzae [TaxId:727] [255944] (1 PDB entry)
  8. 2714002Domain d3lykb2: 3lyk B:88-201 [247559]
    Other proteins in same PDB: d3lyka1, d3lyka3, d3lykb1, d3lykb3
    automated match to d4hoja2

Details for d3lykb2

PDB Entry: 3lyk (more details), 2.1 Å

PDB Description: structure of stringent starvation protein a homolog from haemophilus influenzae
PDB Compounds: (B:) Stringent starvation protein A homolog

SCOPe Domain Sequences for d3lykb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lykb2 a.45.1.0 (B:88-201) automated matches {Haemophilus influenzae [TaxId: 727]}
lmqvypvsrakdrllmlrieqdwyptlakaengtekektsalkqlkeellgiapifqqmp
yfmneefglvdcyvapllwklkhlgveftgtgskaikaymervftrdsflqsvg

SCOPe Domain Coordinates for d3lykb2:

Click to download the PDB-style file with coordinates for d3lykb2.
(The format of our PDB-style files is described here.)

Timeline for d3lykb2: