| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Haemophilus influenzae [TaxId:727] [255944] (1 PDB entry) |
| Domain d3lykb2: 3lyk B:88-201 [247559] Other proteins in same PDB: d3lyka1, d3lyka3, d3lykb1, d3lykb3 automated match to d4hoja2 |
PDB Entry: 3lyk (more details), 2.1 Å
SCOPe Domain Sequences for d3lykb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lykb2 a.45.1.0 (B:88-201) automated matches {Haemophilus influenzae [TaxId: 727]}
lmqvypvsrakdrllmlrieqdwyptlakaengtekektsalkqlkeellgiapifqqmp
yfmneefglvdcyvapllwklkhlgveftgtgskaikaymervftrdsflqsvg
Timeline for d3lykb2: