SCOPe 2.08: Domain d3lyka1: 3lyk A:12-87

Lineage for d3lyka1 (3lyk A:12-87)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [255943] (1 PDB entry)

8. Domain d3lyka1: 3lyk A:12-87 [247556]
   Other proteins in same PDB: d3lyka2, d3lyka3, d3lykb2, d3lykb3
   automated match to d4hoja1

Details for d3lyka1

PDB Entry: 3lyk, 2.1 Å

PDB Description: structure of stringent starvation protein a homolog from haemophilus influenzae

PDB Compounds: (A:) Stringent starvation protein A homolog

SCOPe Domain Sequences for d3lyka1:

Sequence; same for both SEQRES and ATOM records:

>d3lyka1 c.47.1.0 (A:12-87) automated matches {Haemophilus influenzae [TaxId: 727]}
tlfsnkddiychqvkivlaekgvlyenaevdlqalpedlmelnpygtvptlvdrdlvlfn
sriimeylderfphpp

Timeline for d3lyka1:

• d3lyka1 first appeared in SCOPe 2.04
  
• d3lyka1 appears in SCOPe 2.07