| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Haemophilus influenzae [TaxId:727] [255943] (1 PDB entry) |
| Domain d3lyka1: 3lyk A:12-87 [247556] Other proteins in same PDB: d3lyka2, d3lyka3, d3lykb2, d3lykb3 automated match to d4hoja1 |
PDB Entry: 3lyk (more details), 2.1 Å
SCOPe Domain Sequences for d3lyka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lyka1 c.47.1.0 (A:12-87) automated matches {Haemophilus influenzae [TaxId: 727]}
tlfsnkddiychqvkivlaekgvlyenaevdlqalpedlmelnpygtvptlvdrdlvlfn
sriimeylderfphpp
Timeline for d3lyka1: