Lineage for d3ly6c4 (3ly6 C:586-687)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763296Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2763297Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2763298Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2763371Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries)
    GDP-binding protein
  8. 2763385Domain d3ly6c4: 3ly6 C:586-687 [247555]
    Other proteins in same PDB: d3ly6a1, d3ly6a2, d3ly6a5, d3ly6b1, d3ly6b2, d3ly6b5, d3ly6c1, d3ly6c2, d3ly6c5
    automated match to d1kv3a3
    complexed with atp

Details for d3ly6c4

PDB Entry: 3ly6 (more details), 3.14 Å

PDB Description: Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate
PDB Compounds: (C:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d3ly6c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ly6c4 b.1.5.1 (C:586-687) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag
eevkvrmdllplhmglhklvvnfesdklkavkgfrnviigpa

SCOPe Domain Coordinates for d3ly6c4:

Click to download the PDB-style file with coordinates for d3ly6c4.
(The format of our PDB-style files is described here.)

Timeline for d3ly6c4: