SCOPe 2.06: Domain d3ly6c2: 3ly6 C:146-468

Lineage for d3ly6c2 (3ly6 C:146-468)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (3 proteins)

6. Protein Transglutaminase catalytic domain [54045] (4 species)

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (4 PDB entries)
   GDP-binding protein

8. Domain d3ly6c2: 3ly6 C:146-468 [247553]
   Other proteins in same PDB: d3ly6a1, d3ly6a3, d3ly6a4, d3ly6a5, d3ly6b1, d3ly6b3, d3ly6b4, d3ly6b5, d3ly6c1, d3ly6c3, d3ly6c4, d3ly6c5
   automated match to d1kv3a4
   complexed with atp

Details for d3ly6c2

PDB Entry: 3ly6, 3.14 Å

PDB Description: Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate

PDB Compounds: (C:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d3ly6c2:

Sequence; same for both SEQRES and ATOM records:

>d3ly6c2 d.3.1.4 (C:146-468) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk
nagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranhlnklaek

Timeline for d3ly6c2:

• d3ly6c2 first appeared in SCOPe 2.04
  
• d3ly6c2 appears in SCOPe 2.05
  
• d3ly6c2 appears in SCOPe 2.07
  
• d3ly6c2 appears in the current release, SCOPe 2.08