| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
| Protein Transglutaminase catalytic domain [54045] (4 species) |
| Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries) GDP-binding protein |
| Domain d3ly6c2: 3ly6 C:146-468 [247553] Other proteins in same PDB: d3ly6a1, d3ly6a3, d3ly6a4, d3ly6a5, d3ly6b1, d3ly6b3, d3ly6b4, d3ly6b5, d3ly6c1, d3ly6c3, d3ly6c4, d3ly6c5 automated match to d1kv3a4 complexed with atp |
PDB Entry: 3ly6 (more details), 3.14 Å
SCOPe Domain Sequences for d3ly6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ly6c2 d.3.1.4 (C:146-468) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk
nagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranhlnklaek
Timeline for d3ly6c2:
View in 3DDomains from same chain: (mouse over for more information) d3ly6c1, d3ly6c3, d3ly6c4, d3ly6c5 |