SCOPe 2.08: Domain d3ly6b4: 3ly6 B:586-687

Lineage for d3ly6b4 (3ly6 B:586-687)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families)
   automatically mapped to Pfam PF00927

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries)
   GDP-binding protein

8. Domain d3ly6b4: 3ly6 B:586-687 [247551]
   Other proteins in same PDB: d3ly6a1, d3ly6a2, d3ly6a5, d3ly6b1, d3ly6b2, d3ly6b5, d3ly6c1, d3ly6c2, d3ly6c5
   automated match to d1kv3a3
   complexed with atp

Details for d3ly6b4

PDB Entry: 3ly6, 3.14 Å

PDB Description: Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate

PDB Compounds: (B:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d3ly6b4:

Sequence; same for both SEQRES and ATOM records:

>d3ly6b4 b.1.5.1 (B:586-687) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag
eevkvrmdllplhmglhklvvnfesdklkavkgfrnviigpa

Timeline for d3ly6b4:

• d3ly6b4 first appeared in SCOPe 2.04
  
• d3ly6b4 appears in SCOPe 2.07