SCOP 1.73: Domain d1pedc1: 1ped C:1-139,C:314-351

Lineage for d1pedc1 (1ped C:1-139,C:314-351)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)

7. Species Clostridium beijerinckii [TaxId:1520] [50143] (3 PDB entries)

8. Domain d1pedc1: 1ped C:1-139,C:314-351 [24755]
   Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2

Details for d1pedc1

PDB Entry: 1ped, 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1pedc1:

Sequence; same for both SEQRES and ATOM records:

>d1pedc1 b.35.1.2 (C:1-139,C:314-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

Timeline for d1pedc1:

• d1pedc1 first appeared (with stable ids) in SCOP 1.55
  
• d1pedc1 appears in SCOP 1.71
  
• d1pedc1 appears in SCOP 1.75
  
• d1pedc1 appears in the current release, SCOPe 2.08