Lineage for d1pedc1 (1ped C:1-150,C:315-351)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13455Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 13456Species Clostridium beijerinckii [50143] (2 PDB entries)
  8. 13463Domain d1pedc1: 1ped C:1-150,C:315-351 [24755]
    Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2

Details for d1pedc1

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

SCOP Domain Sequences for d1pedc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedc1 b.35.1.2 (C:1-150,C:315-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdmplenavmitdXdlsklvthvyhgfdhieealllmkdkpkd
likavvil

SCOP Domain Coordinates for d1pedc1:

Click to download the PDB-style file with coordinates for d1pedc1.
(The format of our PDB-style files is described here.)

Timeline for d1pedc1: