Lineage for d1pedc1 (1ped C:1-139,C:314-351)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785727Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 2785728Species Clostridium beijerinckii [TaxId:1520] [50143] (4 PDB entries)
  8. 2785743Domain d1pedc1: 1ped C:1-139,C:314-351 [24755]
    Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2
    complexed with zn

Details for d1pedc1

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)
PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1pedc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedc1 b.35.1.2 (C:1-139,C:314-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

SCOPe Domain Coordinates for d1pedc1:

Click to download the PDB-style file with coordinates for d1pedc1.
(The format of our PDB-style files is described here.)

Timeline for d1pedc1: