Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries) GDP-binding protein |
Domain d3ly6a3: 3ly6 A:469-585 [247546] Other proteins in same PDB: d3ly6a1, d3ly6a2, d3ly6a5, d3ly6b1, d3ly6b2, d3ly6b5, d3ly6c1, d3ly6c2, d3ly6c5 automated match to d1kv3a2 complexed with atp |
PDB Entry: 3ly6 (more details), 3.14 Å
SCOPe Domain Sequences for d3ly6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ly6a3 b.1.5.1 (A:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky llnlnlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle
Timeline for d3ly6a3:
View in 3D Domains from same chain: (mouse over for more information) d3ly6a1, d3ly6a2, d3ly6a4, d3ly6a5 |