| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
| Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
| Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (5 PDB entries) GDP-binding protein |
| Domain d3ly6a1: 3ly6 A:4-145 [247544] Other proteins in same PDB: d3ly6a2, d3ly6a3, d3ly6a4, d3ly6a5, d3ly6b2, d3ly6b3, d3ly6b4, d3ly6b5, d3ly6c2, d3ly6c3, d3ly6c4, d3ly6c5 automated match to d2q3za1 complexed with atp |
PDB Entry: 3ly6 (more details), 3.14 Å
SCOPe Domain Sequences for d3ly6a1:
Sequence, based on SEQRES records: (download)
>d3ly6a1 b.1.18.9 (A:4-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
gpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleast
gyqgssfvlghfillfnawcpa
>d3ly6a1 b.1.18.9 (A:4-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
gpapsqeagtkarfplrdavgdwtatvvdqqdctlslqlttpanapiglyrlsleastgy
qgssfvlghfillfnawcpa
Timeline for d3ly6a1:
View in 3DDomains from same chain: (mouse over for more information) d3ly6a2, d3ly6a3, d3ly6a4, d3ly6a5 |