Lineage for d3lxcb2 (3lxc B:324-421)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400671Protein Melibiase [75020] (4 species)
  7. 2400675Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
    alpha-galactosidase A
  8. 2400695Domain d3lxcb2: 3lxc B:324-421 [247540]
    Other proteins in same PDB: d3lxca1, d3lxcb1
    automated match to d3lx9a2
    complexed with bma, fuc, gol, man, nag

Details for d3lxcb2

PDB Entry: 3lxc (more details), 2.35 Å

PDB Description: interconversion of human lysosomal enzyme specificities
PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d3lxcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxcb2 b.71.1.1 (B:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

SCOPe Domain Coordinates for d3lxcb2:

Click to download the PDB-style file with coordinates for d3lxcb2.
(The format of our PDB-style files is described here.)

Timeline for d3lxcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lxcb1