SCOP 1.55: Domain d1pedb1: 1ped B:1-150,B:315-351

Lineage for d1pedb1 (1ped B:1-150,B:315-351)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)

6. Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)

7. Species Clostridium beijerinckii [50143] (2 PDB entries)

8. Domain d1pedb1: 1ped B:1-150,B:315-351 [24754]
   Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2

Details for d1pedb1

PDB Entry: 1ped, 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

SCOP Domain Sequences for d1pedb1:

Sequence; same for both SEQRES and ATOM records:

>d1pedb1 b.35.1.2 (B:1-150,B:315-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdmplenavmitdXdlsklvthvyhgfdhieealllmkdkpkd
likavvil

Timeline for d1pedb1:

• d1pedb1 appears in SCOP 1.57
  
• d1pedb1 appears in the current release, SCOPe 2.08