SCOPe 2.08: Domain d1pedb1: 1ped B:1-139,B:314-351

Lineage for d1pedb1 (1ped B:1-139,B:314-351)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)

7. Species Clostridium beijerinckii [TaxId:1520] [50143] (4 PDB entries)

8. Domain d1pedb1: 1ped B:1-139,B:314-351 [24754]
   Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2
   complexed with zn

Details for d1pedb1

PDB Entry: 1ped, 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

PDB Compounds: (B:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1pedb1:

Sequence; same for both SEQRES and ATOM records:

>d1pedb1 b.35.1.2 (B:1-139,B:314-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

Timeline for d1pedb1:

• d1pedb1 first appeared (with stable ids) in SCOP 1.55
  
• d1pedb1 appears in SCOPe 2.07