Lineage for d3lxba2 (3lxb A:324-426)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077200Protein Melibiase [75020] (4 species)
  7. 2077204Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
    alpha-galactosidase A
  8. 2077227Domain d3lxba2: 3lxb A:324-426 [247534]
    Other proteins in same PDB: d3lxba1, d3lxbb1
    automated match to d3lx9a2
    complexed with gol, nag

Details for d3lxba2

PDB Entry: 3lxb (more details), 2.85 Å

PDB Description: interconversion of human lysosomal enzyme specificities
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3lxba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxba2 b.71.1.1 (A:324-426) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmqmslk

SCOPe Domain Coordinates for d3lxba2:

Click to download the PDB-style file with coordinates for d3lxba2.
(The format of our PDB-style files is described here.)

Timeline for d3lxba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lxba1