| Class b: All beta proteins [48724] (180 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
| Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
| Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) |
| Species Clostridium beijerinckii [TaxId:1520] [50143] (4 PDB entries) |
| Domain d1peda1: 1ped A:1-139,A:314-351 [24753] Other proteins in same PDB: d1peda2, d1pedb2, d1pedc2, d1pedd2 complexed with zn |
PDB Entry: 1ped (more details), 2.15 Å
SCOPe Domain Sequences for d1peda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1peda1 b.35.1.2 (A:1-139,A:314-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
Timeline for d1peda1: