Lineage for d3lwwc_ (3lww C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006405Protein Importin beta [48378] (3 species)
  7. 2006408Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2006423Domain d3lwwc_: 3lww C: [247528]
    automated match to d1qgra_

Details for d3lwwc_

PDB Entry: 3lww (more details), 3.15 Å

PDB Description: Structure of an open and closed conformation of Human Importin Beta bound to the Snurportin1 IBB-domain trapped in the same crystallographic asymmetric unit
PDB Compounds: (C:) Importin subunit beta-1

SCOPe Domain Sequences for d3lwwc_:

Sequence, based on SEQRES records: (download)

>d3lwwc_ a.118.1.1 (C:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
pmihelltegrrsktnkaktlatwatkelrklk

Sequence, based on observed residues (ATOM records): (download)

>d3lwwc_ a.118.1.1 (C:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsarvasnvcwafsslaeaay
eaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsakd
cypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqdalq
isdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglknya
eyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdial
aiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdqen
vhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpm
ihelltegrrsktnkaktlatwatkelrklk

SCOPe Domain Coordinates for d3lwwc_:

Click to download the PDB-style file with coordinates for d3lwwc_.
(The format of our PDB-style files is described here.)

Timeline for d3lwwc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3lwwa_