Lineage for d3lvpb_ (3lvp B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930698Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1930699Species Human (Homo sapiens) [TaxId:9606] [69826] (17 PDB entries)
  8. 1930741Domain d3lvpb_: 3lvp B: [247524]
    automated match to d1p4ob_
    complexed with epe, pdr, so4

Details for d3lvpb_

PDB Entry: 3lvp (more details), 3 Å

PDB Description: Crystal structure of bisphosphorylated IGF1-R Kinase domain (2P) in complex with a bis-azaindole inhibitor
PDB Compounds: (B:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d3lvpb_:

Sequence, based on SEQRES records: (download)

>d3lvpb_ d.144.1.7 (B:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
vyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreri
eflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvla
ppslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdy
yrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfv
megglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen

Sequence, based on observed residues (ATOM records): (download)

>d3lvpb_ d.144.1.7 (B:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
vyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreri
eflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlappsls
kmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkgg
kgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmeggl
ldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen

SCOPe Domain Coordinates for d3lvpb_:

Click to download the PDB-style file with coordinates for d3lvpb_.
(The format of our PDB-style files is described here.)

Timeline for d3lvpb_: