Lineage for d3lvmb1 (3lvm B:1-393)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131631Protein automated matches [190399] (9 species)
    not a true protein
  7. 2131636Species Escherichia coli [TaxId:155864] [255940] (3 PDB entries)
  8. 2131638Domain d3lvmb1: 3lvm B:1-393 [247522]
    Other proteins in same PDB: d3lvmb2
    automated match to d1p3wa_
    complexed with plp

Details for d3lvmb1

PDB Entry: 3lvm (more details), 2.05 Å

PDB Description: crystal structure of e.coli iscs
PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d3lvmb1:

Sequence, based on SEQRES records: (download)

>d3lvmb1 c.67.1.3 (B:1-393) automated matches {Escherichia coli [TaxId: 155864]}
mklpiyldysattpvdprvaekmmqfmtmdgtfgnpasrshrfgwqaeeavdiarnqiad
lvgadpreivftsgatesdnlaikgaanfyqkkgkhiitsktehkavldtcrqleregfe
vtylapqrngiidlkeleaamrddtilvsimhvnneigvvqdiaaigemcrargiiyhvd
atqsvgklpidlsqlkvdlmsfsghkiygpkgigalyvrrkprvrieaqmhggghergmr
sgtlpvhqivgmgeayriakeematemerlrglrnrlwngikdieevylngdlehgapni
lnvsfnyvegeslimalkdlavssgsactsaslepsyvlralglndelahssirfslgrf
tteeeidytielvrksigrlrdlsplwemykqg

Sequence, based on observed residues (ATOM records): (download)

>d3lvmb1 c.67.1.3 (B:1-393) automated matches {Escherichia coli [TaxId: 155864]}
mklpiyldysattpvdprvaekmmqfmtmdgtfgnpasrshrfgwqaeeavdiarnqiad
lvgadpreivftsgatesdnlaikgaanfyqkkgkhiitsktehkavldtcrqleregfe
vtylapqrngiidlkeleaamrddtilvsimhvnneigvvqdiaaigemcrargiiyhvd
atqsvgklpidlsqlkvdlmsfsghkiygpkgigalyvrrkprvrieaqmhggghergmr
sgtlpvhqivgmgeayriakeematemerlrglrnrlwngikdieevylngdlehgapni
lnvsfnyvegeslimalkdlavssgsalepsyvlralglndelahssirfslgrftteee
idytielvrksigrlrdlsplwemykqg

SCOPe Domain Coordinates for d3lvmb1:

Click to download the PDB-style file with coordinates for d3lvmb1.
(The format of our PDB-style files is described here.)

Timeline for d3lvmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lvmb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3lvma_