Lineage for d3lvlb_ (3lvl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131631Protein automated matches [190399] (9 species)
    not a true protein
  7. 2131642Species Escherichia coli [TaxId:562] [255941] (1 PDB entry)
  8. 2131643Domain d3lvlb_: 3lvl B: [247520]
    Other proteins in same PDB: d3lvla_
    automated match to d1p3wa_
    complexed with plp

Details for d3lvlb_

PDB Entry: 3lvl (more details), 3 Å

PDB Description: crystal structure of e.coli iscs-iscu complex
PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d3lvlb_:

Sequence, based on SEQRES records: (download)

>d3lvlb_ c.67.1.3 (B:) automated matches {Escherichia coli [TaxId: 562]}
mklpiyldysattpvdprvaekmmqfmtmdgtfgnpasrshrfgwqaeeavdiarnqiad
lvgadpreivftsgatesdnlaikgaanfyqkkgkhiitsktehkavldtcrqleregfe
vtylapqrngiidlkeleaamrddtilvsimhvnneigvvqdiaaigemcrargiiyhvd
atqsvgklpidlsqlkvdlmsfsghkiygpkgigalyvrrkprvrieaqmhggghergmr
sgtlpvhqivgmgeayriakeematemerlrglrnrlwngikdieevylngdlehgapni
lnvsfnyvegeslimalkdlavssgsactsaslepsyvlralglndelahssirfslgrf
tteeeidytielvrksigrlrdlsplwemykqg

Sequence, based on observed residues (ATOM records): (download)

>d3lvlb_ c.67.1.3 (B:) automated matches {Escherichia coli [TaxId: 562]}
mklpiyldysattpvdprvaekmmqfmtmdgtfgnpasrshrfgwqaeeavdiarnqiad
lvgadpreivftsgatesdnlaikgaanfyqkkgkhiitsktehkavldtcrqleregfe
vtylapqrngiidlkeleaamrddtilvsimhvnneigvvqdiaaigemcrargiiyhvd
atqsvgklpidlsqlkvdlmsfsghkiygpkgigalyvrrkprvrieaqmhggghergmr
sgtlpvhqivgmgeayriakeematemerlrglrnrlwngikdieevylngdlehgapni
lnvsfnyvegeslimalkdlavssgsalepsyvlralglndelahssirfslgrftteee
idytielvrksigrlrdlsplwemykqg

SCOPe Domain Coordinates for d3lvlb_:

Click to download the PDB-style file with coordinates for d3lvlb_.
(The format of our PDB-style files is described here.)

Timeline for d3lvlb_: