SCOPe 2.06: Domain d3lvla_: 3lvl A:

Lineage for d3lvla_ (3lvl A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)

6. Protein automated matches [254586] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:155864] [255942] (1 PDB entry)

8. Domain d3lvla_: 3lvl A: [247519]
   Other proteins in same PDB: d3lvlb_
   automated match to d1r9pa_
   complexed with plp

Details for d3lvla_

PDB Entry: 3lvl, 3 Å

PDB Description: crystal structure of e.coli iscs-iscu complex

PDB Compounds: (A:) NifU-like protein

SCOPe Domain Sequences for d3lvla_:

Sequence; same for both SEQRES and ATOM records:

>d3lvla_ d.224.1.2 (A:) automated matches {Escherichia coli [TaxId: 155864]}
aysekvidhyenprnvgsfdnndenvgsgmvgapacgdvmklqikvndegiiedarfkty
gcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiady
kskre

Timeline for d3lvla_:

• d3lvla_ first appeared in SCOPe 2.04
  
• d3lvla_ appears in SCOPe 2.05
  
• d3lvla_ appears in SCOPe 2.07
  
• d3lvla_ appears in the current release, SCOPe 2.08