Lineage for d3lqca_ (3lqc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774493Family b.18.1.8: N-terminal domain of xrcc1 [49814] (1 protein)
    automatically mapped to Pfam PF01834
  6. 2774494Protein N-terminal domain of xrcc1 [49815] (1 species)
    the single-strand break repair protein
  7. 2774495Species Human (Homo sapiens) [TaxId:9606] [49816] (5 PDB entries)
  8. 2774496Domain d3lqca_: 3lqc A: [247511]
    automated match to d3k77a_
    complexed with co3, na

Details for d3lqca_

PDB Entry: 3lqc (more details), 2.35 Å

PDB Description: X-ray crystal structure of oxidized XRCC1 bound to DNA pol beta Palm thumb domain
PDB Compounds: (A:) DNA repair protein XRCC1

SCOPe Domain Sequences for d3lqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lqca_ b.18.1.8 (A:) N-terminal domain of xrcc1 {Human (Homo sapiens) [TaxId: 9606]}
peirlrhvvscssqdsthcaenllkadtyrkwraakagektisvvlqlekeeqihsvdig
ndgsafvevlvgssaggageqdyevllvtssfmspsesrsgsnpnrvrmfgpdklvraaa
ekrwdrvkivcsqpyskdspfglsfvrfhsp

SCOPe Domain Coordinates for d3lqca_:

Click to download the PDB-style file with coordinates for d3lqca_.
(The format of our PDB-style files is described here.)

Timeline for d3lqca_: