Lineage for d3lq5b1 (3lq5 B:9-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718713Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2718714Protein automated matches [227124] (1 species)
    not a true protein
  7. 2718715Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)
  8. 2718722Domain d3lq5b1: 3lq5 B:9-150 [247509]
    Other proteins in same PDB: d3lq5a_
    automated match to d3mi9b1
    complexed with slq

Details for d3lq5b1

PDB Entry: 3lq5 (more details), 3 Å

PDB Description: Structure of CDK9/CyclinT in complex with S-CR8
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3lq5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lq5b1 a.74.1.0 (B:9-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymhr
fymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseaylq
qvqdlvilesiilqtlgfelti

SCOPe Domain Coordinates for d3lq5b1:

Click to download the PDB-style file with coordinates for d3lq5b1.
(The format of our PDB-style files is described here.)

Timeline for d3lq5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lq5b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3lq5a_