Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cell division protein kinase 9, CDK9 [160810] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160811] (6 PDB entries) Uniprot P50750 8-325 |
Domain d3lq5a_: 3lq5 A: [247508] Other proteins in same PDB: d3lq5b1, d3lq5b2 automated match to d4imya_ complexed with slq |
PDB Entry: 3lq5 (more details), 3 Å
SCOPe Domain Sequences for d3lq5a_:
Sequence, based on SEQRES records: (download)
>d3lq5a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} dsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalr eikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlse ikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnry tnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlc gsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqrid sddalnhdffwsdpmpsdlkgm
>d3lq5a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} dsvecpfcdevskyeklakigqfgevfkarhrktgqkvalkkvlmenekegfpitalrei kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslapnrytnrvvtlwyrppel llgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdny elyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdp mpsdlkgm
Timeline for d3lq5a_: