Lineage for d3lq5a_ (3lq5 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218757Protein Cell division protein kinase 9, CDK9 [160810] (1 species)
  7. 2218758Species Human (Homo sapiens) [TaxId:9606] [160811] (6 PDB entries)
    Uniprot P50750 8-325
  8. 2218762Domain d3lq5a_: 3lq5 A: [247508]
    Other proteins in same PDB: d3lq5b1, d3lq5b2
    automated match to d4imya_
    complexed with slq

Details for d3lq5a_

PDB Entry: 3lq5 (more details), 3 Å

PDB Description: Structure of CDK9/CyclinT in complex with S-CR8
PDB Compounds: (A:) Cell division protein kinase 9

SCOPe Domain Sequences for d3lq5a_:

Sequence, based on SEQRES records: (download)

>d3lq5a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
dsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalr
eikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlse
ikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnry
tnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlc
gsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqrid
sddalnhdffwsdpmpsdlkgm

Sequence, based on observed residues (ATOM records): (download)

>d3lq5a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
dsvecpfcdevskyeklakigqfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln
glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslapnrytnrvvtlwyrppel
llgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdny
elyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdp
mpsdlkgm

SCOPe Domain Coordinates for d3lq5a_:

Click to download the PDB-style file with coordinates for d3lq5a_.
(The format of our PDB-style files is described here.)

Timeline for d3lq5a_: