SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3lq4a2 (3lq4 A:471-700)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108851Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2108852Protein automated matches [227126] (17 species)
    not a true protein
  7. 2108925Species Escherichia coli [TaxId:83334] [255938] (3 PDB entries)
  8. 2108928Domain d3lq4a2: 3lq4 A:471-700 [247503]
    Other proteins in same PDB: d3lq4a1, d3lq4a3, d3lq4b1, d3lq4b3
    automated match to d2ieaa1
    complexed with epe, mg, po4, tdp; mutant

Details for d3lq4a2

PDB Entry: 3lq4 (more details), 1.98 Å

PDB Description: E. coli pyruvate dehydrogenase complex E1 E235A mutant with high TDP concentration
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lq4a2:

Sequence, based on SEQRES records: (download)

>d3lq4a2 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records): (download)

>d3lq4a2 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

SCOPe Domain Coordinates for d3lq4a2:

Click to download the PDB-style file with coordinates for d3lq4a2.
(The format of our PDB-style files is described here.)

Timeline for d3lq4a2: