Lineage for d3lq2b3 (3lq2 B:701-886)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603362Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1603363Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1603529Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 1603530Protein automated matches [226991] (5 species)
    not a true protein
  7. 1603549Species Escherichia coli [TaxId:83334] [255939] (3 PDB entries)
  8. 1603551Domain d3lq2b3: 3lq2 B:701-886 [247501]
    Other proteins in same PDB: d3lq2a1, d3lq2a2, d3lq2b1, d3lq2b2
    automated match to d2ieaa3
    complexed with epe, mg, po4, tdp; mutant

Details for d3lq2b3

PDB Entry: 3lq2 (more details), 1.96 Å

PDB Description: e. coli pyruvate dehydrogenase complex e1 e235a mutant with low tdp concentration
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lq2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lq2b3 c.48.1.0 (B:701-886) automated matches {Escherichia coli [TaxId: 83334]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOPe Domain Coordinates for d3lq2b3:

Click to download the PDB-style file with coordinates for d3lq2b3.
(The format of our PDB-style files is described here.)

Timeline for d3lq2b3: