Lineage for d1kevb1 (1kev B:1-150,B:315-351)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies) Superfamily b.35.1: GroES-like [50129] (2 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins) 
Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) Species Clostridium beijerinckii [50143] (2 PDB entries) 
Domain d1kevb1: 1kev B:1-150,B:315-351 [24750]
Other proteins in same PDB: d1keva2, d1kevb2, d1kevc2, d1kevd2
Details for d1kevb1
PDB Entry: 1kev (more details), 2.05 Å
PDB Description: structure of nadp-dependent alcohol dehydrogenase
SCOP Domain Sequences for d1kevb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kevb1 b.35.1.2 (B:1-150,B:315-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdmplenavmitdXdlsklvthvyhgfdhieealllmkdkpkd
likavvil
SCOP Domain Coordinates for d1kevb1:
Click to download the PDB-style file with coordinates for d1kevb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kevb1:
View in 3D
