Lineage for d1kevb1 (1kev B:1-150,B:315-351)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13455Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 13456Species Clostridium beijerinckii [50143] (2 PDB entries)
  8. 13458Domain d1kevb1: 1kev B:1-150,B:315-351 [24750]
    Other proteins in same PDB: d1keva2, d1kevb2, d1kevc2, d1kevd2

Details for d1kevb1

PDB Entry: 1kev (more details), 2.05 Å

PDB Description: structure of nadp-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1kevb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kevb1 b.35.1.2 (B:1-150,B:315-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdmplenavmitdXdlsklvthvyhgfdhieealllmkdkpkd
likavvil

SCOP Domain Coordinates for d1kevb1:

Click to download the PDB-style file with coordinates for d1kevb1.
(The format of our PDB-style files is described here.)

Timeline for d1kevb1: