SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1kevb1 (1kev B:1-139,B:314-351)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2047809Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2047810Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2047938Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 protein domains)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2048150Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 2048151Species Clostridium beijerinckii [TaxId:1520] [50143] (4 PDB entries)
  8. 2048157Domain d1kevb1: 1kev B:1-139,B:314-351 [24750]
    Other proteins in same PDB: d1keva2, d1kevb2, d1kevc2, d1kevd2
    complexed with ndp, zn

Details for d1kevb1

PDB Entry: 1kev (more details), 2.05 Å

PDB Description: structure of nadp-dependent alcohol dehydrogenase
PDB Compounds: (B:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1kevb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kevb1 b.35.1.2 (B:1-139,B:314-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

SCOPe Domain Coordinates for d1kevb1:

Click to download the PDB-style file with coordinates for d1kevb1.
(The format of our PDB-style files is described here.)

Timeline for d1kevb1: