Lineage for d3lq2b1 (3lq2 B:56-470)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108664Family c.36.1.10: TK-like PP module [88760] (3 protein domains)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2108715Protein automated matches [254698] (2 species)
    not a true protein
  7. 2108716Species Escherichia coli [TaxId:83334] [255937] (3 PDB entries)
  8. 2108718Domain d3lq2b1: 3lq2 B:56-470 [247499]
    Other proteins in same PDB: d3lq2a2, d3lq2a3, d3lq2b2, d3lq2b3
    automated match to d2ieaa2
    complexed with epe, mg, po4, tdp; mutant

Details for d3lq2b1

PDB Entry: 3lq2 (more details), 1.96 Å

PDB Description: E. coli pyruvate dehydrogenase complex E1 E235A mutant with low TDP concentration
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lq2b1:

Sequence, based on SEQRES records: (download)

>d3lq2b1 c.36.1.10 (B:56-470) automated matches {Escherichia coli [TaxId: 83334]}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemda
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd
gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

Sequence, based on observed residues (ATOM records): (download)

>d3lq2b1 c.36.1.10 (B:56-470) automated matches {Escherichia coli [TaxId: 83334]}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemda
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

SCOPe Domain Coordinates for d3lq2b1:

Click to download the PDB-style file with coordinates for d3lq2b1.
(The format of our PDB-style files is described here.)

Timeline for d3lq2b1: