Lineage for d3lpwb2 (3lpw B:103-197)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762269Domain d3lpwb2: 3lpw B:103-197 [247495]
    Other proteins in same PDB: d3lpwa3, d3lpwb3
    automated match to d1bpva_
    complexed with mpd, mrd

Details for d3lpwb2

PDB Entry: 3lpw (more details), 1.65 Å

PDB Description: Crystal structure of the FnIII-tandem A77-A78 from the A-band of titin
PDB Compounds: (B:) A77-A78 domain from Titin

SCOPe Domain Sequences for d3lpwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpwb2 b.1.2.0 (B:103-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plppgkitlmdvtrnsvslswekpehdggsrilgyivemqtkgsdkwatcatvkvteati
tgliqgeeysfrvsaqnekgisdprqlsvpviakd

SCOPe Domain Coordinates for d3lpwb2:

Click to download the PDB-style file with coordinates for d3lpwb2.
(The format of our PDB-style files is described here.)

Timeline for d3lpwb2: