SCOPe 2.04: Domain d3lplb3: 3lpl B:701-886

Lineage for d3lplb3 (3lpl B:701-886)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.0: automated matches [227237] (1 protein)
   not a true family

6. Protein automated matches [226991] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [255939] (3 PDB entries)

8. Domain d3lplb3: 3lpl B:701-886 [247491]
   Other proteins in same PDB: d3lpla1, d3lpla2, d3lplb1, d3lplb2
   automated match to d2ieaa3
   complexed with epe, mg, po4, tdp; mutant

Details for d3lplb3

PDB Entry: 3lpl, 2.1 Å

PDB Description: e. coli pyruvate dehydrogenase complex e1 component e571a mutant

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lplb3:

Sequence; same for both SEQRES and ATOM records:

>d3lplb3 c.48.1.0 (B:701-886) automated matches {Escherichia coli [TaxId: 83334]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

Timeline for d3lplb3:

• d3lplb3 is new in SCOPe 2.04-stable
  
• d3lplb3 appears in SCOPe 2.05
  
• d3lplb3 appears in the current release, SCOPe 2.08