SCOPe 2.05: Domain d3lplb2: 3lpl B:471-700

Lineage for d3lplb2 (3lpl B:471-700)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [255938] (3 PDB entries)

8. Domain d3lplb2: 3lpl B:471-700 [247490]
   Other proteins in same PDB: d3lpla1, d3lpla3, d3lplb1, d3lplb3
   automated match to d2ieaa1
   complexed with epe, mg, po4, tdp; mutant

Details for d3lplb2

PDB Entry: 3lpl, 2.1 Å

PDB Description: e. coli pyruvate dehydrogenase complex e1 component e571a mutant

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lplb2:

Sequence, based on SEQRES records:

>d3lplb2 c.36.1.0 (B:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginalgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records):

>d3lplb2 c.36.1.0 (B:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginalgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

Timeline for d3lplb2:

• d3lplb2 first appeared in SCOPe 2.04
  
• d3lplb2 appears in SCOPe 2.06
  
• d3lplb2 appears in the current release, SCOPe 2.08