Lineage for d3lpla3 (3lpl A:701-886)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880787Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2880788Protein automated matches [226991] (9 species)
    not a true protein
  7. 2880818Species Escherichia coli [TaxId:83334] [255939] (3 PDB entries)
  8. 2880823Domain d3lpla3: 3lpl A:701-886 [247488]
    Other proteins in same PDB: d3lpla1, d3lpla2, d3lplb1, d3lplb2
    automated match to d2ieaa3
    complexed with epe, mg, po4, tdp; mutant

Details for d3lpla3

PDB Entry: 3lpl (more details), 2.1 Å

PDB Description: e. coli pyruvate dehydrogenase complex e1 component e571a mutant
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lpla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpla3 c.48.1.0 (A:701-886) automated matches {Escherichia coli [TaxId: 83334]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOPe Domain Coordinates for d3lpla3:

Click to download the PDB-style file with coordinates for d3lpla3.
(The format of our PDB-style files is described here.)

Timeline for d3lpla3: