![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.10: TK-like PP module [88760] (3 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
![]() | Protein automated matches [254698] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [255937] (3 PDB entries) |
![]() | Domain d3lpla1: 3lpl A:56-470 [247486] Other proteins in same PDB: d3lpla2, d3lpla3, d3lplb2, d3lplb3 automated match to d2ieaa2 complexed with epe, mg, po4, tdp; mutant |
PDB Entry: 3lpl (more details), 2.1 Å
SCOPe Domain Sequences for d3lpla1:
Sequence, based on SEQRES records: (download)
>d3lpla1 c.36.1.10 (A:56-470) automated matches {Escherichia coli [TaxId: 83334]} isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft
>d3lpla1 c.36.1.10 (A:56-470) automated matches {Escherichia coli [TaxId: 83334]} isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft
Timeline for d3lpla1: